A database of hormones and their receptors| A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10496 |
| Swiss-prot Accession number | P69107 (Sequence in FASTA format) |
| Description | Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)]. |
| Source organism | Salmo salar (Atlantic salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the GnRH family. |
| Tissue Specificity | Brain |
| Post translational modification | N/A |
| Function | Stimulates the secretion of gonadotropins |
| Protein Length | 82 Amino acids |
| Molecular weight | 9143 |
| References | 1 PubMed abstract 1587389 |
| Domain Name | N/A |
| Hormone Name | Gonadoliberin-3 |
| Mature Hormone Sequence | QHWSYGWLPG |
| Position of mature hormone in Pre-Hormone protein | 10 Residues from position (24-33) |
| Receptor | N/A |
| Gene ID | 100136578 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10763 |
| Swiss-prot Accession number | P10814 (Sequence in FASTA format) |
| Description | Somatotropin precursor (Growth hormone). |
| Source organism | Salmo salar (Atlantic salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23894 |
| References | 1 PubMed abstract 2704622 2 PubMed abstract 1562611 3 PubMed abstract 2753360 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin |
| Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLMAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKLETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | 100136588 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10781 |
| Swiss-prot Accession number | O73824 (Sequence in FASTA format) |
| Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
| Source organism | Salmo salar (Atlantic salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
| Protein Length | 139 Amino acids |
| Molecular weight | 15449 |
| References | 1 Martin S.A.M., Wallner W., Youngson A.F., Smith T.; "Differential expression of Atlantic salmon (Salmo salar) thyrotropinbeta subunit mRNA and its cDNA sequence."; J. Fish Biol. 54:757-766(1998).
|
| Domain Name | Cys_knot |
| Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
| Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYHTLA |
| Position of mature hormone in Pre-Hormone protein | 119 Residues from position (21-139) |
| Receptor | N/A |
| Gene ID | 100136355 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 11025 |
| Swiss-prot Accession number | P48096 (Sequence in FASTA format) |
| Description | Prolactin precursor (PRL). |
| Source organism | Salmo salar (Atlantic salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmo. |
| Subcellular location | Secreted |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | N/A |
| Protein Length | 210 Amino acids |
| Molecular weight | 23396 |
| References | 1 Martin S.A.M., Ferguson A., Youngson A.F.; Submitted (FEB-1995) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 2925076 |
| Domain Name | Hormone_1 |
| Hormone Name | Prolactin |
| Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPETC |
| Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
| Receptor | N/A |
| Gene ID | 100136580 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |